PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn248561
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 182aa    MW: 20604.5 Da    PI: 6.3426
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn248561genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.71.5e-41141141101
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+lapyfp +++ kf ++h+ FGasn++k+l++lpe+ reda+ss+vyeA+ar++dPvyG++g+i +lq+q+++l+aela++++
  Achn248561  14 PCAACKILRRRCAEKCILAPYFPPTDTLKFTIAHRHFGASNIIKFLQDLPESLREDAVSSMVYEANARLKDPVYGCAGTIYHLQNQVSELQAELAKTQA 112
                 7***********************************************************************************************999 PP

      DUF260 100 el 101
                 +l
  Achn248561 113 QL 114
                 85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.88813114IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-4114111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MNLNLNLNLI DRRPCAACKI LRRRCAEKCI LAPYFPPTDT LKFTIAHRHF GASNIIKFLQ  60
DLPESLREDA VSSMVYEANA RLKDPVYGCA GTIYHLQNQV SELQAELAKT QAQLISRRCE  120
KADLQALVYP TFMSQQQQQQ QQQQHVPFDH SLDFALDDSK FGMLGSLSGV EANLEEISEF  180
W*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409877.11e-65hypothetical protein EUTSA_v10017165mg
RefseqXP_013614548.18e-66PREDICTED: LOB domain-containing protein 11-like
RefseqXP_013681453.18e-66PREDICTED: LOB domain-containing protein 11-like
SwissprotQ9SK086e-66LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0D2ZT589e-66A0A0D2ZT58_BRAOL; Uncharacterized protein
TrEMBLV4LL881e-65V4LL88_EUTSA; Uncharacterized protein
STRINGBra035698.1-P4e-65(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.17e-64LOB domain-containing protein 11